PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00018755-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family bHLH
Protein Properties Length: 193aa    MW: 21514.5 Da    PI: 7.9408
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00018755-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH37.15.7e-121871255
                        HHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                 HLH  2 rrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                        r+  + +Er+RR++++  ++eL +l+P++s+ ++   s  + L +A +YIk+Lq
  WALNUT_00018755-RA 18 RTDRKTIERNRRNHMKALYSELNSLVPHQSSRDQVAASLPDQLDEAAKYIKQLQ 71
                        778899**********************86777777*****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.31E-111485IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000832.83E-61475No hitNo description
PROSITE profilePS5088811.1911670IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.104.0E-121874IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.0E-81871IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003530.00182276IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MQARLGISME NNPSSSSRTD RKTIERNRRN HMKALYSELN SLVPHQSSRD QVAASLPDQL  60
DEAAKYIKQL QKNLEEMKKK KDSLMGIERP EASTNSGVTV GLRLPQIEIQ EIGFGLKVVA  120
ITGLDFHFVF KETVRVLHEE GAEIINAGFS VVEDTVFHTI HAKVAGESAS MGNEAARISE  180
RLKKFVINDV NVI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006377370.13e-83hypothetical protein POPTR_0011s05320g
TrEMBLA5C0F41e-86A5C0F4_VITVI; Putative uncharacterized protein
STRINGPOPTR_0011s05320.18e-83(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9063498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.14e-44bHLH family protein